Domain assignment for gi|387625763|ref|YP_006061935.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
49 236 Pseudouridine synthase 2.4e-44 Pseudouridine synthase RsuA/RluD 0.0000321 1ksk A:60-231 Alignments
1 59 Alpha-L RNA-binding motif 0.000000000000314 Pseudouridine synthase RsuA N-terminal domain 0.016 1vio A:0-57 Alignments

Protein Sequence Details

Sequence length 240
Comment putative ribosomal small subunit pseudouridine synthase B [Streptococcus pneumoniae INV104]
Sequence
MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKIDEIRFDGQVLEYEEFVYYMMNKPKGVISATEDPKHRTVMDLLDDLARSKEVFPVGRLDIDTHGLLLLTNDGQLAHVLLSPKRHVDKTYLAQVKGIMTQEDVETFAEGIPLKDFTCQPAILELVSIDTEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDENLERGEWRRLTKEELEILRANII

Download

Sequence (FASTA)