Domain assignment for gi|387625743|ref|YP_006061915.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
27 198 Acyl-CoA N-acyltransferases (Nat) 1.86e-37 N-acetyl transferase, NAT 0.0034 1nsl A: Alignments

Protein Sequence Details

Sequence length 231
Comment GNAT family acetyltransferase [Streptococcus pneumoniae INV104]
Sequence
MPVNEYGQMIGESMEGYTPGELPSIDFLEGRYARIEALSVEKHAEDLLAVYGPDTPQEMWTYLFQEPVADMGELVSLLHQMLARKDRFYYAIIDKATGKALGSFSLMRIDQNNRVIEVGAVTFSPELRGTRIGTEAQYLLARYVFEELNYRRYEWKCDALNLPSRRAAERLSFIYEGTFRQAVVYKGRTRDTDWLSMIDKDWPQVKDRLETWLRPENFDKNGQQYKSLREL

Download

Sequence (FASTA)