Domain assignment for gi|387625731|ref|YP_006061903.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 242 P-loop containing nucleoside triphosphate hydrolases 2.66e-81 ABC transporter ATPase domain-like 0.000000918 1v43 A:7-245 Alignments
238 356 MOP-like 0.0000000000109 ABC-transporter additional domain 0.02 1q12 A:236-370 Alignments

Protein Sequence Details

Sequence length 363
Comment ABC transporter ATP-binding protein [Streptococcus pneumoniae INV104]
Sequence
MSEIKIINAKKIYHDVPVIENLNITIPKESLFTLLGPSGCGKTTLLRMIAGFNSIEGGEFYFDDTKINNMEPSKRNIGMVFQNYAIFPHLTVRDNVAFGLMQKKVPKEELIQQTNKYLELMQIAQYADRKPDKLSGGQQQRVTLACALAVNPSVLLMDEPLSNLEAKLRLDIRQAIREIQHEVGITTVYVTHDQEEAMAISDQIAVMKDGVIQQIGRPKELYHKPANEFVATFIGRTNIIPANLEKRSDGAYIVFSDGYALRMLALDQVEEQAIHVSIRPEEFIKDESGDIEGTISDSVYLGLNTEYFIETGFASKIQVSEESTFEEELQKGNRIRLRINTQKLNIFSADGSQNLIKGVNHGT

Download

Sequence (FASTA)