Domain assignment for gi|387625726|ref|YP_006061898.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 128 Prokaryotic ribosomal protein L17 1.57e-43 Prokaryotic ribosomal protein L17 0.0000999 2zjr K:3-115 Alignments

Protein Sequence Details

Sequence length 128
Comment 50S ribosomal protein L17 [Streptococcus pneumoniae INV104]
Sequence
MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVEKMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNGGYTRILKTEPRRGDAAPMAIIELV

Download

Sequence (FASTA)