Domain assignment for gi|387625710|ref|YP_006061882.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 122 Ribosomal protein L14 2.88e-49 Ribosomal protein L14 0.0000015 1whi A: Alignments

Protein Sequence Details

Sequence length 122
Comment 50S ribosomal protein L14 [Streptococcus pneumoniae INV104]
Sequence
MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPGGAVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIREDKTPRGTRIFGPVARELREGGFMKIVSLAPEVL

Download

Sequence (FASTA)