Domain assignment for gi|387625705|ref|YP_006061877.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 114 Ribosomal protein L22 2.75e-44 Ribosomal protein L22 0.0000493 2zjr P:8-134 Alignments

Protein Sequence Details

Sequence length 114
Comment 50S ribosomal protein L22 [Streptococcus pneumoniae INV104]
Sequence
MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPNKAAEIILKVLNSAVANAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTAHITVAVAEK

Download

Sequence (FASTA)