Domain assignment for gi|387625696|ref|YP_006061868.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 154 Acyl-CoA N-acyltransferases (Nat) 6.6e-20 N-acetyl transferase, NAT 0.017 1s7k A:3-176 Alignments

Protein Sequence Details

Sequence length 168
Comment acetyltransferase (GNAT) family protein [Streptococcus pneumoniae INV104]
Sequence
MELRRPRLADKKAVLDMMTEFEKSQSAHDGGFWDVEDFSYEEWLEGNRNKEMGIWLPENRVPSIQFVLFGESGCALGFLNLRLRLNEGLLNYAGHIGYSIRPSERGKGYAKETLRQGLQVAKEKNIKKALVTCSVNNPASRAVILANGGIFEDARNGVERYWIEVANE

Download

Sequence (FASTA)