Domain assignment for gi|387625676|ref|YP_006061848.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
65 131 RuvA domain 2-like 2.72e-18 DNA helicase RuvA subunit, middle domain 0.0027 1bvs A:64-134 Alignments
1 62 Nucleic acid-binding proteins 1.71e-17 DNA helicase RuvA subunit, N-terminal domain 0.0023 1cuk A:1-64 Alignments
150 195 DNA helicase RuvA subunit, C-terminal domain 0.00000000523 DNA helicase RuvA subunit, C-terminal domain 0.0057 1ixs A: Alignments

Protein Sequence Details

Sequence length 197
Comment Holliday junction DNA helicase RuvA [Streptococcus pneumoniae INV104]
Sequence
MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEAQIYVHQVVREDAHLLYGFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETKNITYLTKFPKIGKKTAQQMVLDLEGKVVVAGDGLPAKVAVQASAENQELEEAMEAMLALGYKATELKKIKKFFEGTTDTAENYIKSALKMLVK

Download

Sequence (FASTA)