Domain assignment for gi|387625670|ref|YP_006061842.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 381 MFS general substrate transporter 2.88e-27 LacY-like proton/sugar symporter 0.049 1pv7 A: Alignments

Protein Sequence Details

Sequence length 392
Comment Permease [Streptococcus pneumoniae INV104]
Sequence
MKNLIKLLIIRLIVNLADSVFYIVALWHVSNNYSSSMFLGIFIAVNYLPDLLLIFFGPVIDRVNPQKILIISILVQLAVAVIFLLLLNQISFWVIMSLVFISVMASSISYVIEDVLIPQVVEYDKIVFANSLFSISYKVLDSIFNSFASFLQVAVGFILLVKIDIGIFLLALFILLLLKFRTSNANIENFSFKYYKREVLQGTKFILNNKLLFKTSISLTLINFFYSFQTVVVPIFSIRYFDGPIFYGIFLTIAGLGGILGNMLAPIVIKYLKSNQIVGVFLFLNGSSWLVAIVIKDYTLSLILFFVCFMSKGVFNIIFNSLYQQIPPHQLLGRVNTTIDSIISFGMPIGSLVAGTLIDLNIELVLIAISIPYFLFSYIFYTDNGLKEFSIY

Download

Sequence (FASTA)