Domain assignment for gi|387625664|ref|YP_006061836.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View

Protein Sequence Details

Sequence length 152
Comment hypothetical protein INV104_01350 [Streptococcus pneumoniae INV104]
Sequence
MKKQVFHDAAAGVLIGLILSILFSLIYAPNTYAPLNPYSLIGQVMDQHQVHGALVLLYCTLIWAAIGMLFNFGNRLFSRDWSMLRATLTHFFLMLAGFVPLATLAGWFPFHWIFYLQLIIEFAIVYLIIWAILYKREAKKVDHINQLLEHRK

Download

Sequence (FASTA)