Domain assignment for gi|387625642|ref|YP_006061814.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 248 LmbE-like 7.72e-25 LmbE-like 0.009 1uan A: Alignments

Protein Sequence Details

Sequence length 249
Comment putative acetyltransferase [Streptococcus pneumoniae INV104]
Sequence
MSDNTKYIFLSPHLDDAIFSCGDYISKLTSEGEIVLVITIFSGYPLSQQLQPSAKQFHKLCNLGKYPIEERKKEDRLACERLQCDFRHLSYYECLYRKDRNGNFLYRHIYSKLKNEDTLKNDIIKELLMHLDDKCVVYCPLSLGDHVDHVFVNSIGRALEFMRYKVIYYEDFPYVSDSSMVSYMGKTKELKMYQEELDEKHYIDRISSILCYKSQILIIWKSVEKLLNNIKELYLRNGAAYSIRFWIKK

Download

Sequence (FASTA)