Domain assignment for gi|387625637|ref|YP_006061809.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
12 143 Acyl-CoA N-acyltransferases (Nat) 2.27e-22 N-acetyl transferase, NAT 0.0074 1tiq A: Alignments

Protein Sequence Details

Sequence length 145
Comment acetyltransferase (GNAT) family protein [Streptococcus pneumoniae INV104]
Sequence
MIEIKRIQQQPDLAQAIYAVMAAVYLVSPWTLEQIQADLSQDQTWYALAYDGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTDKEIFLEVRKSNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMKREIDEG

Download

Sequence (FASTA)