Domain assignment for gi|387625606|ref|YP_006061778.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 201 Alpha-L RNA-binding motif 4.84e-67 Ribosomal protein S4 0.00000343 1c06 A: Alignments

Protein Sequence Details

Sequence length 203
Comment 30S ribosomal protein S4 [Streptococcus pneumoniae INV104]
Sequence
MSRYTGPSWKQARRLGLSLTGTGKELARRNYVPGQHGPNNRSKLSEYGLQLAEKQKLRFTYGVGEKQFRNLFVQATKIKGGILGFNFMLLLERRLDNVVYRLGLATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSLKVPAILEAVEATLGRPAFVSFDAEKLEGSLTRLPERDEINPEINEALVVEFYNKML

Download

Sequence (FASTA)