Domain assignment for gi|387625597|ref|YP_006061769.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 93 Rhodanese/Cell cycle control phosphatase 2.1e-28 Single-domain sulfurtransferase 0.011 1gmx A: Alignments

Protein Sequence Details

Sequence length 98
Comment hypothetical protein INV104_00590 [Streptococcus pneumoniae INV104]
Sequence
METSISMADFYGKYQNENLELIDVREAHEFQAGHAPGAKNLPLSTLEQGYKELKPDHEYYVICQGGVRSASTCQFLISQGLTVTNVEGGMNAWPGQVE

Download

Sequence (FASTA)