Domain assignment for gi|387625550|ref|YP_006061722.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 77 Alpha-L RNA-binding motif 6.12e-20 Heat shock protein 15 kD 0.015 1dm9 A: Alignments

Protein Sequence Details

Sequence length 88
Comment S4 domain containing protein [Streptococcus pneumoniae INV104]
Sequence
MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVNDQVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV

Download

Sequence (FASTA)