Domain assignment for ENSAMEP00000016337 from Ailuropoda melanoleuca 76_1

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure
6 274 Cysteine proteinases 1.08e-81 Papain-like 0.0000152 1f2a A:

Protein Sequence Details

Sequence length 276
Comment pep:known_by_projection scaffold:ailMel1:GL193136.1:735200:747940:-1 gene:ENSAMEG00000015490 transcript:ENSAMET00000017015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESLNRHRYLNSVFPHENSSAVYGINQFSYLFPEEFKAIYLRSKSSRLPRYRAEAQTSIPNVSLPLRFDWRDKRVVTQVRNQQTCGGCWAFSVVGAVESAYAIKGEPLEALSVQQVIDCSYNNYGCSGGSTVSALHWLNKTQVKLVRDSEYPFKAQNGLCHYFSDSQSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVVVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKIGSTPYWIVRNSWGSSWGVDGYARVKMGGNICGIADSVSAVFV

Download

Sequence (FASTA)