Domain assignment for ENSAMEP00000012018 from Ailuropoda melanoleuca 76_1

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure
29 340 Cysteine proteinases 9.15e-121 Papain-like 0.00000000107 1cs8 A:

Protein Sequence Details

Sequence length 341
Comment pep:novel scaffold:ailMel1:GL192745.1:73667:76818:1 gene:ENSAMEG00000011406 transcript:ENSAMET00000012525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFFLGFWNMHPSLFLAALCLGMASAAPRRDQSLDAHWSHWKEAHGKLYDKDEEGQRRRVWEKNMKMIDQHNEEYSQGQHSFTMAMNAFGDLTSEEFKQVLNDLKIQKPEEGNVFQAPLFAEIPASVDWREKGYVTPVKYQGHCQSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSWPQNNDGCRGGLMDNAFRYVKDNGGLDSAESYPYLGRNESCKYRPEKSAANLTTFWSVSNKEDGLMTTVATVGPVSAAVDSSLHSFQFYKKGIYYDPNCRSNRLNHAVLVVGYGFEGEESENKKYWIIKNSWGTNWGMKGYMLLAKDRDNHCGIATMASFPVV

Download

Sequence (FASTA)